Press Release Summary = This week AnaSpec, one of the world's largest providers of custom and catalog peptides, introduced thirteen (13) new peptides for drug discovery research.
Press Release Body = San Jose, CA - May 18, 2007
This week AnaSpec, one of the world's largest providers of custom and catalog peptides, introduced thirteen (13) new peptides for drug discovery research.
Helodermin (Cat# 61867-05) Helodermin was originaly isolated from the venom of the lizard Heloderma suspectum. It is a secretin/VIP-related peptide with sequence similarities to Vasoactive Intestinal Peptide (VIP); Growth Hormone-Releasing Factor (GRF); and peptide histidine-isoleucin (PHI). Sequence: HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP Sequence (3-Letter): H-His-Ser-Asp-Ala-Ile-Phe-Thr-Gln-Gln-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-OH Reference(s): Vandermeeers, A. et al. Eur. J. Biochem. 164, 321 (1987); Dejda, A. et al. Pol. J. Pharmacol. 55, 747 (2003).
Activity-Dependent Neurotrophic Factor; ADNF (Cat# 61929) Activity-dependent neurotrophic factor (ADNF) is a nine amino acid peptide originally purified from conditioned medium of astrocytes. ADNF protects neurons from death induced by beta-Amyloid at extremely low concentrations. Sequence: SALLRSIPA Sequence (3-Letter): H-Ser-Ala-Leu-Leu-Arg-Ser-Ile-Pro-Ala-OH Reference(s): Chiba, T. et al. J. Neurosci. 25, 10252 (2005); D.Brenneman and I.Gozes J. Clin. Invest. 97, 2299 (1996).
Beta-Amyloid (10-35) (Cat# 61931) This is an experimentally defined model peptide for the fibril formation from the core residues of the beta-Amyloid peptides of Alzheimer\'s disease. This peptide adopts the structure of an extended parallel beta-sheet at pH 7.4 in high-resolution structural studies. Sequence: YEVHHQKLVFFAEDVGSNKGAIIGLM Sequence (3-Letter): H-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-OH Reference(s): Lakdawala, A. et al. Am. Chem. Soc. 124, 15150 (2002); Benzinger, S. et al. Biochem. 39, 3491 (2000); Trzesniewska, K.et al. Acta Neurobiol. Exp. 64, 41 (2004).
Angiotensin II Receptor; AT2; Amino Terminal Fragment (Cat# 61901) This peptide is derived from the amino terminus of the rat Angiotensin II; Ang II; AT2 receptor. Ang II plays a major role in the regulation of blood pressure and fluid; and electrolyte balance. Sequence: MKDNFSFAATSRNITSS Sequence (3-Letter): H-Met-Lys-Asp-Asn-Phe-Ser-Phe-Ala-Ala-Thr-Ser-Arg-Asn-Ile-Thr-Ser-Ser-OH Reference(s): Ozono, R. et al. Hypertens. 30, 1238 (1997); Wang, Z. et al. Hypertens. 33, 96 (1999).
Nuclear Export Signal; NES p53 (Cat# 61883) This peptide is a nuclear export signal (NES) that regulates subcellular localization and nuclear-cytoplasmic shuttling of p53. Appropriate subcellular localization is crucial for regulating p53 function. p53 export is mediated by this highly conserved leucine-rich nuclear export signal located in its tetramerization domain. Mutation of NES residues prevents p53 export and hampers tetramer formation. Sequence: FRELNEALELKD Sequence (3-Letter): H-Phe-Arg-Glu-Leu-Asn-Glu-Ala-Leu-Glu-Leu-Lys-Asp-OH Reference(s): Turner, J. et al. J. Cell Sci. 117, 3061 (2004); M. Ashcroft and K. Vousden Oncogene 18, 7637 (1999); Stommel, J. et al. EMBO J. 18, 1660 (1999).
Nuclear Export Signal; NES MAPKK (Cat# 61888) This peptide is a functional nuclear export signal (NES) of mitogen-activated protein kinase kinase (MAPKK); a classical NES peptide. Sequence: ALQKKLEELELD Sequence (3-Letter): H-Ala-Leu-Gln-Lys-Lys-Leu-Glu-Glu-Leu-Glu-Leu-Asp-OH Reference(s): Kawamori, D. et al. Diab. 52, 2896 (2003); Gadal, O. et al. Mol. Cell. Biol. 21, 3405 (2001).
Nuclear Export Signal; NES HIV Rev (Cat# 61890) This peptide is a functional nuclear export signal (NES) of the human immunodeficiency virus Rev protein. Sequence: LQLPPLERLTLD Sequence (3-Letter): H-Leu-Gln-Leu-Pro-Pro-Leu-Glu-Arg-Leu-Thr-Leu-Asp-OH Reference(s): Kawamori, D. et al. Diab. 52, 2896 (2003); Gadal, O. et al. Mol. Cell. Biol. 21, 3405 (2001).
Activated Protein C (390-404); human (Cat# 61862) The peptide region containing residues 390-404 in Activated Protein C (APC) is essential for anticoagulant activity and is available for interaction with antibodies or with other proteins; such as the macromolecular substrates Factors Va or VIIIa. APC regulates blood coagulation by proteolytic inactivation of the blood coagulation cofactors Va and VIIIa. Sequence: YGVYTKVSRYLDWIH Sequence (3-Letter): H-Tyr-Gly-Val-Tyr-Thr-Lys-Val-Ser-Arg-Tyr-Leu-Asp-Trp-Ile-His-OH Reference(s): Yegneswaran, S. J. Biol. Chem. 278, 33312 (2003); Mesters, R. et al. J. Biol. Chem. 266, 24514 (1991).
Translation Initiation Factor 2B; pS13; FAM-labeled (Cat# 61740) This is a FAM-labeled single phosphorylated amidated peptide corresponding to the translation initiation factor e-subunit of 2B (eIF2B). It is selective for GSK3 and therefore useful for measuring GSK3 activity in cell extracts that may contain other Ser/Thr kinases. The references below correspond to the non-labeled peptide. Sequence: 5-FAM-RRAAEELDSRAG-pS-PQL-NH2 Sequence (3-Letter): 5-FAM-Arg-Arg-Ala-Ala-Glu-Glu-Leu-Asp-Ser-Arg-Ala-Gly-pSer-Pro-Gln-Leu-NH2 Reference(s): Oreņa, S. et al. J. Biol. Chem. 275, 15765 (2000); Kang Ho Kim, et al. J. Biol. Chem. 279, 51999 (2004); Nikoulina, S. et al. Diabetes 51, 2190 (2002); Brady, M. et al. J. Biol. Chem. 273, 14063 (1998).
Doc-6 (130-145) (Cat# 61894) This peptide is a sequence from fragment 130 to 145 of Doc-6. Dok-6; a novel member of the Dok-4/5 subclass of the p62Dok family that can associate with receptor tyrosine kinase (Ret) and also serves as a substrate of the Ret signaling cascade. Dok-6 expression in vivo overlaps significantly with that of Ret. Dok family members are modular docking proteins consisting of an N-terminal pleckstrin homology (PH) domain; a central PTB domain; and a variable C-terminal region. A complete sequence of Doc-6 can be found in the reference listed below. Sequence: GVQREQNERFNVYLMP Sequence (3-Letter): H-Gly-Val-Gln-Arg-Glu-Gln-Asn-Glu-Arg-Phe-Asn-Val-Tyr-Leu-Met-Pro-OH Reference(s): Crowder, R. et al. J. Biol. Chem. 279, 42072 (2004).
Pannexin-1 Fragment (4512) (Cat# 61903) This is a pannexin-1 fragment used in generating anti-pannexin-1 antibody. Antibody 4512 is directed against this peptide sequence located in the putative first extracellular loop of pannexin 1. Pannexins represent a recently discovered second family of gap junction proteins in vertebrates. Pannexin 1also forms nonjunctional membrane channels that provide a passageway from the cytoplasm to the extracellular space for molecules in the size range of second messengers. Pannexin channels could mediate ATP-induced ATP release. Sequence: VQQKSSLQSESGN Sequence (3-Letter): H-Val-Gln-Gln-Lys-Ser-Ser-Leu-Gln-Ser-Glu-Ser-Gly-Asn-OH Reference(s): Locovei, S. et al. PNAS 103, 7655 (2006).
Pannexin-1 Fragment (4515) (Cat# 61904) This is a Pannexin-1 fragment used in generating anti-pannexin-1 antibody. Antibody 4515 was directed against carboxyl-terminal amino acids. Pannexins represent a recently discovered second family of gap junction proteins in vertebrates. Pannexin 1; in addition to forming gap junctions in paired oocytes; also forms nonjunctional membrane channels that provide a passageway from the cytoplasm to the extracellular space for molecules in the size range of second messengers. Pannexin-1 forms a stress-sensitive; ATP-permeable channel. Sequence: EKNSRQRLLNPS Sequence (3-Letter): H-Glu-Lys-Asn-Ser-Arg-Gln-Arg-Leu-Leu-Asn-Pro-Ser-OH Reference(s): Locovei, S. et al. PNAS 103, 7655 (2006).
Invertebrate Tachykinin-I; OctTK-I (Cat# 61933) This novel invertebrate tachikinin-like peptide (Inv-TK) OctTK-I with C-terminal consensus motif F-X-GLM-NH2 was characterized from salivary gland of Octopus vulgaris. It displays structural and functional similarities with vertebrate tachykinins. Sequence: KPPSSSEFIGLM-NH2 Sequence (3-Letter): H-Lys-Pro-Pro-Ser-Ser-Ser-Glu-Phe-Ile-Gly-Leu-Met-NH2 Reference(s): Satake, H. et al. Zool. Sci. 20, 533 (2003); Kanda, A. et al. Pept. 24, 35 (2003).
For more information visit www.anaspec.com
Company Info AnaSpec, Inc. is a leading provider of integrated proteomics solutions to pharmaceutical, biotech, and academic research institutions throughout the world. With a vision for innovation through synergy, AnaSpec focuses on three core technologies: peptides, detection reagents, and combinatorial chemistry. Established in 1993, AnaSpec\'s headquarters and manufacturing facilities are located in San Jose, CA.
2022
